<?xml version="1.0" encoding="UTF-8"?><rss version="2.0"
	xmlns:content="http://purl.org/rss/1.0/modules/content/"
	xmlns:wfw="http://wellformedweb.org/CommentAPI/"
	xmlns:dc="http://purl.org/dc/elements/1.1/"
	xmlns:atom="http://www.w3.org/2005/Atom"
	xmlns:sy="http://purl.org/rss/1.0/modules/syndication/"
	xmlns:slash="http://purl.org/rss/1.0/modules/slash/"
	>

<channel>
	<title>image compression &#8211; stoimen&#039;s web log</title>
	<atom:link href="/tag/image-compression/feed/" rel="self" type="application/rss+xml" />
	<link></link>
	<description>on web development</description>
	<lastBuildDate>Tue, 13 Feb 2018 08:18:15 +0000</lastBuildDate>
	<language>en-US</language>
	<sy:updatePeriod>hourly</sy:updatePeriod>
	<sy:updateFrequency>1</sy:updateFrequency>
	<generator>https://wordpress.org/?v=5.0.3</generator>
	<item>
		<title>Computer Algorithms: Lossy Image Compression with Run-Length Encoding</title>
		<link>/2012/05/03/computer-algorithms-lossy-image-compression-with-run-length-encoding/</link>
		<comments>/2012/05/03/computer-algorithms-lossy-image-compression-with-run-length-encoding/#comments</comments>
		<pubDate>Thu, 03 May 2012 20:27:06 +0000</pubDate>
		<dc:creator><![CDATA[Stoimen]]></dc:creator>
				<category><![CDATA[algorithms]]></category>
		<category><![CDATA[Coding theory]]></category>
		<category><![CDATA[Data compression]]></category>
		<category><![CDATA[data compression algorithm]]></category>
		<category><![CDATA[Graphics file formats]]></category>
		<category><![CDATA[image compression]]></category>
		<category><![CDATA[Image processing]]></category>
		<category><![CDATA[Information theory]]></category>
		<category><![CDATA[jpeg]]></category>
		<category><![CDATA[Lossless data compression]]></category>
		<category><![CDATA[lossy algorithm]]></category>
		<category><![CDATA[Lossy compression]]></category>
		<category><![CDATA[PCX]]></category>
		<category><![CDATA[PHP]]></category>
		<category><![CDATA[Pixel]]></category>
		<category><![CDATA[Run-length encoding]]></category>
		<category><![CDATA[suitable algorithm]]></category>
		<category><![CDATA[Technology/Internet]]></category>

		<guid isPermaLink="false">/?p=3078</guid>
		<description><![CDATA[Introduction Run-length encoding is a data compression algorithm that helps us encode large runs of repeating items by only sending one item from the run and a counter showing how many times this item is repeated. Unfortunately this technique is useless when trying to compress natural language texts, because they don’t have long runs of &#8230; <a href="/2012/05/03/computer-algorithms-lossy-image-compression-with-run-length-encoding/" class="more-link">Continue reading <span class="screen-reader-text">Computer Algorithms: Lossy Image Compression with Run-Length Encoding</span> <span class="meta-nav">&#8594;</span></a><div class='yarpp-related-rss'>

Related posts:<ol>
<li><a href="/2012/01/09/computer-algorithms-data-compression-with-run-length-encoding/" rel="bookmark" title="Computer Algorithms: Data Compression with Run-length Encoding">Computer Algorithms: Data Compression with Run-length Encoding </a></li>
<li><a href="/2012/01/16/computer-algorithms-data-compression-with-bitmaps/" rel="bookmark" title="Computer Algorithms: Data Compression with Bitmaps">Computer Algorithms: Data Compression with Bitmaps </a></li>
<li><a href="/2012/01/23/computer-algorithms-data-compression-with-diagram-encoding-and-pattern-substitution/" rel="bookmark" title="Computer Algorithms: Data Compression with Diagram Encoding and Pattern Substitution">Computer Algorithms: Data Compression with Diagram Encoding and Pattern Substitution </a></li>
<li><a href="/2012/01/30/computer-algorithms-data-compression-with-relative-encoding/" rel="bookmark" title="Computer Algorithms: Data Compression with Relative Encoding">Computer Algorithms: Data Compression with Relative Encoding </a></li>
</ol>
</div>
]]></description>
				<content:encoded><![CDATA[<h2>Introduction</h2>
<p><a href="/2012/01/09/computer-algorithms-data-compression-with-run-length-encoding/" title="Computer Algorithms: Data Compression with Run-length Encoding">Run-length encoding</a> is a data compression algorithm that helps us encode large runs of repeating items by only sending one item from the run and a counter showing how many times this item is repeated. Unfortunately this technique is useless when trying to compress natural language texts, because they don’t have long runs of repeating elements. In the other hand RLE is useful when it comes to image compression, because images happen to have long runs pixels with identical color. </p>
<p>As you can see on the following picture we can compress consecutive pixels by only replacing each run with one pixel from it and a counter showing how many items it contains.</p>
<figure id="attachment_3101" style="width: 619px" class="wp-caption alignnone"><a href="/wp-content/uploads/2012/05/1.LosslessRLEforImages.png"><img src="/wp-content/uploads/2012/05/1.LosslessRLEforImages.png" alt="Lossless RLE for Images" title="Lossless RLE for Images" width="619" height="216" class="size-full wp-image-3101" srcset="/wp-content/uploads/2012/05/1.LosslessRLEforImages.png 619w, /wp-content/uploads/2012/05/1.LosslessRLEforImages-300x104.png 300w" sizes="(max-width: 619px) 100vw, 619px" /></a><figcaption class="wp-caption-text">Although lossless RLE can be quite effective for image compression, it is still not the best approach!</figcaption></figure>
<p>In this case we can save only counters for pixels that are repeated more than once. Such the input stream “aaaabbaba” will be compressed as “[4]a[2]baba”. </p>
<p>Actually there are several ways run-length encoding can be used for image compression. A possible way of compressing a picture can be either row by row or column by column, as it is shown on the picture below.</p>
<p><figure id="attachment_3102" style="width: 621px" class="wp-caption alignnone"><a href="/wp-content/uploads/2012/05/2.RowbyRowandColbyCol.png"><img src="/wp-content/uploads/2012/05/2.RowbyRowandColbyCol.png" alt="Row by row or column by column compression" title="Row by row or column by column compression" width="621" height="300" class="size-full wp-image-3102" srcset="/wp-content/uploads/2012/05/2.RowbyRowandColbyCol.png 621w, /wp-content/uploads/2012/05/2.RowbyRowandColbyCol-300x144.png 300w" sizes="(max-width: 621px) 100vw, 621px" /></a><figcaption class="wp-caption-text">Row by row or column by column compression.</figcaption></figure><span id="more-3078"></span></p>
<p>The problem in practice is that sometimes compressing row by row may be effective, while in other cases the same approach is very ineffective. This is illustrated by the image below.</p>
<figure id="attachment_3103" style="width: 621px" class="wp-caption alignnone"><a href="/wp-content/uploads/2012/05/3.EffectiveandIneffectiveCompression.png"><img src="/wp-content/uploads/2012/05/3.EffectiveandIneffectiveCompression.png" alt="Effective and Ineffective Compression" title="Effective and Ineffective Compression" width="621" height="328" class="size-full wp-image-3103" srcset="/wp-content/uploads/2012/05/3.EffectiveandIneffectiveCompression.png 621w, /wp-content/uploads/2012/05/3.EffectiveandIneffectiveCompression-300x158.png 300w" sizes="(max-width: 621px) 100vw, 621px" /></a><figcaption class="wp-caption-text">Sometimes image compression may be done only after some preprocessing that can help us understand the best compression approach!</figcaption></figure>
<p>Obviously run-length encoding is a very good approach when compressing images, however when we talk about big images with millions of pixels it’s somehow natural to come with some lossy compression.</p>
<h2>Overview</h2>
<p>Lossy RLE is a very suitable algorithm when it comes to images, because in most of the cases large images do appear to have big spaces of identical pixel colors, i.e. when the half of the picture is the blue sky. By using lossy compression we can skip very short runs.</p>
<p>First we’ve to say how long will be the shortest run that we will keep in the compression. For instance if 3 is the shortest run, then runs of 2 consecutive elements will be skipped.</p>
<figure id="attachment_3104" style="width: 621px" class="wp-caption alignnone"><a href="/wp-content/uploads/2012/05/4.LossessImageRow.png"><img src="/wp-content/uploads/2012/05/4.LossessImageRow.png" alt="Lossless Pixel Row" title="Lossless Pixel Row" width="621" height="173" class="size-full wp-image-3104" srcset="/wp-content/uploads/2012/05/4.LossessImageRow.png 621w, /wp-content/uploads/2012/05/4.LossessImageRow-300x83.png 300w" sizes="(max-width: 621px) 100vw, 621px" /></a><figcaption class="wp-caption-text">Lossless compression of a pixel row in some cases can be very inefective!</figcaption></figure>
<p>Of course if we set the shortest run to be only one element long, this will make our compression completely lossless, which isn’t very effective. However when we talk about millions of pixels even runs of three or more elements are very short, so it’s up to the developer to decide how long will be the shortest run.</p>
<h3>Some Examples</h3>
<p>Let&#8217;s first define the shortest run that we will keep untouched to be at least three element long.</p>
<figure id="attachment_3105" style="width: 620px" class="wp-caption alignnone"><a href="/wp-content/uploads/2012/05/5.LossyImageRow.png"><img src="/wp-content/uploads/2012/05/5.LossyImageRow.png" alt="Lossy Pixel Row" title="Lossy Pixel Row" width="620" height="273" class="size-full wp-image-3105" srcset="/wp-content/uploads/2012/05/5.LossyImageRow.png 620w, /wp-content/uploads/2012/05/5.LossyImageRow-300x132.png 300w" sizes="(max-width: 620px) 100vw, 620px" /></a><figcaption class="wp-caption-text">We can lose some information that is invisbile to the eye.</figcaption></figure>
<p>The above image is compressed more effectively than the lossless pixel row from the previous picture.</p>
<p>The thing is how to merge short runs. For instance the following three runs have to be blended into one color run.</p>
<figure id="attachment_3106" style="width: 620px" class="wp-caption alignnone"><a href="/wp-content/uploads/2012/05/6.BlendingShortRuns.png"><img src="/wp-content/uploads/2012/05/6.BlendingShortRuns.png" alt="Blending Short Runs" title="Blending Short Runs" width="620" height="199" class="size-full wp-image-3106" srcset="/wp-content/uploads/2012/05/6.BlendingShortRuns.png 620w, /wp-content/uploads/2012/05/6.BlendingShortRuns-300x96.png 300w" sizes="(max-width: 620px) 100vw, 620px" /></a><figcaption class="wp-caption-text">We must chose how to blend short runs!</figcaption></figure>
<p>We can choose the middle color (option #1) or not, but this will always depend on the picture and it will be effective in some cases and ineffective in other.</p>
<h2>Implementation</h2>
<p>Implementing run-length encoding is easy in general. Here’s a simple <a href="/category/php/" title="PHP on stoimen.com">PHP</a> code that shows a lossy RLE.</p>
<pre lang="PHP">
/**
 * Compresses an input list of objects by losing some data using
 * run-length encoding
 * 
 * @param mixed $objectList
 * @param int $minLength
 */
function lossyRLE($objectList, $minLength)
{
	$len 		= is_string($objectList) 
			? strlen($objectList)		// string as an input stream
			: count($objectList);		// array as an input stream
	$j 		= 1;
	$compressed = array();				// compressed output
	
	for ($i = 0; $i < $len; $i++) {
		if (isset($objectList[$i+1]) &#038;&#038; $objectList[$i] == $objectList[$i+1]) {
			$j++;
		} else {
			$l = count($compressed);
			// This is where RLE is converted to a lossy algorithm!
			// In case the run is shorter than a predefined length the
			// algorithm will skip these elements and will stretch the last
			// saved run.
			// NOTE: this logic can be changed in order to take other
			// decisions depending on the goals.
			if ($j < $minLength &#038;&#038; $j < $l) {
				$compressed[$l-1]['count'] += $j;
			} else {
				$compressed[] = array('count' => $j, $objectList[$i]);
			}
			$j = 1;
		}
	}
	
	return $compressed;
}

$input = 'aaaabbaabbbbba';

// aaaaaaaabbbbbb
lossyRLE($input, 3);
</pre>
<p>The code above can be modified in order to work with more complex data. Let’s say we have a “pixel” abstraction as on the example above.</p>
<pre lang="PHP">
/**
 * Pixel abstraction
 */
class Pixel
{
	private $_color = null;
	
	public function __construct($color = '')
	{
		$this->_color = $color;
	}
	
	public function getColor() 
	{
		return $this->_color;
	}
}

/**
 * Inits the pixels array
 * 
 * @param array $pixels
 */
function init(array &$pixels = array())
{
	$colors = array('red', 'green', 'blue');
	
	for ($i = 0; $i < 100; $i++) {
		$pixels[] = new Pixel($colors[mt_rand(0, 2)]);
	}
}

/**
 * Compresses an input list of objects by losing some data using
 * run-length encoding
 * 
 * @param mixed $objectList
 * @param int $minLength
 */
function lossyRLE($objectList, $minLength)
{
	$len 		= is_string($objectList) 
			? strlen($objectList)		// string as an input stream
			: count($objectList);		// array as an input stream
	$j 		= 1;
	$compressed = array();				// compressed output
	
	for ($i = 0; $i < $len; $i++) {
		if (isset($objectList[$i+1]) &#038;&#038; $objectList[$i] == $objectList[$i+1]) {
			$j++;
		} else {
			$l = count($compressed);
			// This is where RLE is converted to a lossy algorithm!
			// In case the run is shorter than a predefined length the
			// algorithm will skip these elements and will stretch the last
			// saved run.
			// NOTE: this logic can be changed in order to take other
			// decisions depending on the goals.
			if ($j < $minLength &#038;&#038; $l > $j) {
				$compressed[$l-1]['count'] += $j;
			} else {
				$compressed[] = array('count' => $j, $objectList[$i]);
			}
			$j = 1;
		}
	}
	
	return $compressed;
}

$pixels = array();

// initializes the pixels array
init($pixels);

$compressed = lossyRLE($pixels, 3);

print_r($compressed);
</pre>
<h2>Complexity</h2>
<p>In general lossless RLE compelxity is linear &#8211; O(n) where n is the number of items from the input stream. Even with the small modification above the complexity remains linear. However we can modify the compression in a slightly different manner (in order to get the middle value from consecutive short runs). This will somehow affect the complexity of the algorithm, of course.</p>
<h2>Application</h2>
<p>Run-length encoding isn’t a very effective option when compressing texts, but for images where long runs of the identical pixels happen to occur it is quite useful. </p>
<figure id="attachment_3107" style="width: 622px" class="wp-caption alignnone"><a href="/wp-content/uploads/2012/05/7.LossyRLE.png"><img src="/wp-content/uploads/2012/05/7.LossyRLE.png" alt="Lossy RLE in Practice" title="Lossy RLE in Practice" width="622" height="483" class="size-full wp-image-3107" srcset="/wp-content/uploads/2012/05/7.LossyRLE.png 622w, /wp-content/uploads/2012/05/7.LossyRLE-300x232.png 300w" sizes="(max-width: 622px) 100vw, 622px" /></a><figcaption class="wp-caption-text"> </figcaption></figure>
<p>Nevertheless RLE is easy to convert into a lossy algorithm, that makes it very suitable for image compression.</p>
<div class='yarpp-related-rss'>
<p>Related posts:<ol>
<li><a href="/2012/01/09/computer-algorithms-data-compression-with-run-length-encoding/" rel="bookmark" title="Computer Algorithms: Data Compression with Run-length Encoding">Computer Algorithms: Data Compression with Run-length Encoding </a></li>
<li><a href="/2012/01/16/computer-algorithms-data-compression-with-bitmaps/" rel="bookmark" title="Computer Algorithms: Data Compression with Bitmaps">Computer Algorithms: Data Compression with Bitmaps </a></li>
<li><a href="/2012/01/23/computer-algorithms-data-compression-with-diagram-encoding-and-pattern-substitution/" rel="bookmark" title="Computer Algorithms: Data Compression with Diagram Encoding and Pattern Substitution">Computer Algorithms: Data Compression with Diagram Encoding and Pattern Substitution </a></li>
<li><a href="/2012/01/30/computer-algorithms-data-compression-with-relative-encoding/" rel="bookmark" title="Computer Algorithms: Data Compression with Relative Encoding">Computer Algorithms: Data Compression with Relative Encoding </a></li>
</ol></p>
</div>
]]></content:encoded>
			<wfw:commentRss>/2012/05/03/computer-algorithms-lossy-image-compression-with-run-length-encoding/feed/</wfw:commentRss>
		<slash:comments>5</slash:comments>
		</item>
		<item>
		<title>Computer Algorithms: Data Compression with Bitmaps</title>
		<link>/2012/01/16/computer-algorithms-data-compression-with-bitmaps/</link>
		<comments>/2012/01/16/computer-algorithms-data-compression-with-bitmaps/#comments</comments>
		<pubDate>Mon, 16 Jan 2012 09:35:24 +0000</pubDate>
		<dc:creator><![CDATA[Stoimen]]></dc:creator>
				<category><![CDATA[algorithms]]></category>
		<category><![CDATA[PHP]]></category>
		<category><![CDATA[Algorithm]]></category>
		<category><![CDATA[bitmap]]></category>
		<category><![CDATA[bitmap compressing algorithm]]></category>
		<category><![CDATA[Bzip2]]></category>
		<category><![CDATA[Coding theory]]></category>
		<category><![CDATA[Computing]]></category>
		<category><![CDATA[Data compression]]></category>
		<category><![CDATA[gif]]></category>
		<category><![CDATA[Graphics file formats]]></category>
		<category><![CDATA[image compression]]></category>
		<category><![CDATA[Information theory]]></category>
		<category><![CDATA[JSON]]></category>
		<category><![CDATA[Lossless data compression]]></category>
		<category><![CDATA[Run-length encoding]]></category>
		<category><![CDATA[Technology/Internet]]></category>

		<guid isPermaLink="false">/?p=2604</guid>
		<description><![CDATA[Overview In my previous post we saw how to compress data consisting of very long runs of repeating elements. This type of compression is known as &#8220;run-length encoding&#8221; and can be very handy when transferring data with no loss. The problem is that the data must follow a specific format. Thus the string “aaaaaaaabbbbbbbb” can &#8230; <a href="/2012/01/16/computer-algorithms-data-compression-with-bitmaps/" class="more-link">Continue reading <span class="screen-reader-text">Computer Algorithms: Data Compression with Bitmaps</span> <span class="meta-nav">&#8594;</span></a><div class='yarpp-related-rss'>

Related posts:<ol>
<li><a href="/2012/01/30/computer-algorithms-data-compression-with-relative-encoding/" rel="bookmark" title="Computer Algorithms: Data Compression with Relative Encoding">Computer Algorithms: Data Compression with Relative Encoding </a></li>
<li><a href="/2012/01/09/computer-algorithms-data-compression-with-run-length-encoding/" rel="bookmark" title="Computer Algorithms: Data Compression with Run-length Encoding">Computer Algorithms: Data Compression with Run-length Encoding </a></li>
<li><a href="/2012/01/23/computer-algorithms-data-compression-with-diagram-encoding-and-pattern-substitution/" rel="bookmark" title="Computer Algorithms: Data Compression with Diagram Encoding and Pattern Substitution">Computer Algorithms: Data Compression with Diagram Encoding and Pattern Substitution </a></li>
<li><a href="/2012/05/03/computer-algorithms-lossy-image-compression-with-run-length-encoding/" rel="bookmark" title="Computer Algorithms: Lossy Image Compression with Run-Length Encoding">Computer Algorithms: Lossy Image Compression with Run-Length Encoding </a></li>
</ol>
</div>
]]></description>
				<content:encoded><![CDATA[<h2>Overview</h2>
<p>In <a href="/2012/01/09/computer-algorithms-data-compression-with-run-length-encoding/" title="Computer Algorithms: Data Compression with Run-length Encoding">my previous post</a> we saw how to compress data consisting of very long runs of repeating elements. This type of compression is known as &#8220;run-length encoding&#8221; and can be very handy when transferring data with no loss. The problem is that the data must follow a specific format. Thus the string <strong>“aaaaaaaabbbbbbbb”</strong> can be compressed as <strong>“a8b8”</strong>. Now a string with length 16 can be compressed as a string with length 4, which is 25% of its initial length without loosing any information. There will be a problem in case the characters (elements) were dispersed in a different way. What would happen if the characters are the same, but they don’t form long runs? What if the string was <strong>“abababababababab”</strong>? The same length, the same characters, but we cannot use run-length encoding! Indeed using this algorithm we’ll get at best the same string.</p>
<p>In this case, however, we can see another fact. The string consists of too many repeating elements, although not arranged one after another. We can compress this string with a bitmap. This means that we can save the positions of the occurrences of a given element with a sequence of bits, which can be easily converted into a decimal value. In the example above the string <strong>“abababababababab”</strong> can be compressed as <strong>“1010101010101010”</strong>, which is <strong>43690</strong> in decimals, and even better <strong>AAAA</strong> in hexadecimal. Thus the long string can be compressed. When decompressing (decoding) the message we can convert again from decimal/hexadecimal into binary and match the occurrences of the characters. Well, the example above is too simple, but let’s say only one of the characters is repeating and the rest of the string consists of different characters like this: <strong>“abacadaeafagahai”</strong>. Then we can use bitmap only for the character “a” &#8211; <strong>“1010101010101010”</strong> and compress it as <strong>“AAAA bcdefghi”</strong>. As you can see all the example strings are exactly 16 characters and that is a limitation. To use bitmaps with variable length of the data is a bit tricky and it is not always easy (if possible) to decompress it.</p>
<p><figure id="attachment_2624" style="width: 620px" class="wp-caption alignnone"><a href="/wp-content/uploads/2012/01/Run-lengthvs.BitmapCompression.png"><img src="/wp-content/uploads/2012/01/Run-lengthvs.BitmapCompression.png" alt="Bitmap Compression" title="Bitmap Compression" width="620" class="size-full wp-image-2624" srcset="/wp-content/uploads/2012/01/Run-lengthvs.BitmapCompression.png 1140w, /wp-content/uploads/2012/01/Run-lengthvs.BitmapCompression-300x160.png 300w, /wp-content/uploads/2012/01/Run-lengthvs.BitmapCompression-1024x547.png 1024w" sizes="(max-width: 1140px) 100vw, 1140px" /></a><figcaption class="wp-caption-text">Basically bitmap compression saves the positions of an element that is repeated very often in the message!</figcaption></figure><br />
<span id="more-2604"></span><br />
In the other hand bitmap compression  is not only applicable on strings. We can compress also arrays, objects or any kind of data. The example from my previous post is very suitable. Then we had to transfer a large array from a server to the client (browser) using <a href="/tag/json/" title="JSON on stoimen.com/blog">JSON</a>. The data then was very suitable for “run-length encoding”. Now let’s assume we have the same data &#8211; a set of different years, which this time are dispersed in a different way. </p>
<pre lang="PHP">
$data = array(
	0 	=> 1991,
	1 	=> 1992,
	2 	=> 1993,
	3 	=> 1994,
	4 	=> 1991,
	5 	=> 1992,
	6 	=> 1993,
	7 	=> 1992,
	8 	=> 1991,
	9 	=> 1991,
	10 	=> 1991,
	11 	=> 1992,
	12 	=> 1992,
	13 	=> 1991,
	14 	=> 1991,
	15 	=> 1992,	
	...
);
</pre>
<p>The JSON will encoded message will be the following (a simple but yet very large javascript array).</p>
<pre lang="PHP">
[1991,1992,1993,1994,1991,1992,1993,1992,1991,1991,1991,1992,1992,1991,1991,1992, ...]
</pre>
<p>However if we use bitmap compression we’ll get a &#8220;shorter&#8221; array.</p>
<pre lang="PHP">
$data = array(
	0 => array(1991, '1000100011100110'),
	1 => array(1992, '0100010100011001'),
	2 => array(1993, '0010001000000000'),
	3 => array(1994, '0001000000000000'),
);
</pre>
<p>Now the JSON is:</p>
<pre lang="PHP">
[[1991,"1000100011100110"],[1992,"0100010100011001"],[1993,"0010001000000000"],[1994,"0001000000000000"]]
</pre>
<p>It is obvious that the compression ratio is getting better and better as the uncompressed data grows. In fact, most of us know bitmap compression from images, because this algorithm is largely used for image compression. We can imagine how successful it can be when compressing black and white images (as black and white can be represented as 0 and 1s). Actually it is used for more than two colors (256 for instance) and again the level of compression is very high.</p>
<h2>Implementation</h2>
<p>The following implementation on <a href="/category/php/" title="PHP on stoimen.com">PHP</a> aims only to illustrate the bitmap compressing algorithm. As we know this algorithm can be applicable for any kind of data structures. </p>
<pre lang="PHP">
// too many repeating "a" characters
$msg = 'aazahalavaatalawacamaahakafaaaqaaaiauaacaaxaauaxaaaaaapaayatagaaoafaawayazavaaaazaaabararaaaaakakaaqaarazacajaazavanazaaaeanaaoajauaaaaaxalaraaapabataaavaaab';

function bitmap($message) 
{
	$i = 0;
	$bits = $rest = '';
	
	while ($v = $message[$i]) {
		if ($v == 'a') {
			$bits .= '1';
		} else {
			$bits .= '0';
			$rest .= $v;
		}
		$i++;
	}
	
	return number_format(bindec($bits), 0, '.', '') . $rest;;
}

echo bitmap($msg);

// uncompressed: 
acaaaaadaaaabalaaeaaaaganaaxakaavawamaasavajawaaaayaauaaadalanagaeaeamaarafalaazaaaiasaanaahaaazaraxaalaahaaawaaajasamahaajaakarapanaakaoakaanawalaacamauaamaal
// compressed:
152299251941730035874325065523548237677352452096zhlvtlwcmhkfqiucxuxpytgofwyzvzbrrkkqrzcjzvnzenojuxlrpbtvb
</pre>
<h2>Application</h2>
<p>This algorithm is very useful when there is an element in our data that repeats very often, so you need to investigate the nature of the data you want to compress. Actually because of this fact this algorithm is used for image compression as <a href="http://en.wikipedia.org/wiki/Portable_Network_Graphics" title="Portable Network Graphics" target="_blank">PNG8</a> or <a href="http://en.wikipedia.org/wiki/Graphics_Interchange_Format" title="Graphics Interchange Format" target="_blank">GIF</a>.</p>
<div class='yarpp-related-rss'>
<p>Related posts:<ol>
<li><a href="/2012/01/30/computer-algorithms-data-compression-with-relative-encoding/" rel="bookmark" title="Computer Algorithms: Data Compression with Relative Encoding">Computer Algorithms: Data Compression with Relative Encoding </a></li>
<li><a href="/2012/01/09/computer-algorithms-data-compression-with-run-length-encoding/" rel="bookmark" title="Computer Algorithms: Data Compression with Run-length Encoding">Computer Algorithms: Data Compression with Run-length Encoding </a></li>
<li><a href="/2012/01/23/computer-algorithms-data-compression-with-diagram-encoding-and-pattern-substitution/" rel="bookmark" title="Computer Algorithms: Data Compression with Diagram Encoding and Pattern Substitution">Computer Algorithms: Data Compression with Diagram Encoding and Pattern Substitution </a></li>
<li><a href="/2012/05/03/computer-algorithms-lossy-image-compression-with-run-length-encoding/" rel="bookmark" title="Computer Algorithms: Lossy Image Compression with Run-Length Encoding">Computer Algorithms: Lossy Image Compression with Run-Length Encoding </a></li>
</ol></p>
</div>
]]></content:encoded>
			<wfw:commentRss>/2012/01/16/computer-algorithms-data-compression-with-bitmaps/feed/</wfw:commentRss>
		<slash:comments>1</slash:comments>
		</item>
	</channel>
</rss>
